- FLYWCH2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86227
- This antibody was developed against Recombinant Protein corresponding to amino acids: SKDSTKVAGA KRKGVHCVMS LGVPGPATLA KALLQTHPEA QRAIEAAPQE PEQKRSRQDP GTDRTEDSGL AAGPPEAAGE NFA
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- FLYWCH2
- Unconjugated
- Rabbit
- FLYWCH family member 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFA
Specifications/Features
Available conjugates: Unconjugated